jueves, 31 de octubre de 2013

Tres miradas a la luna

Acabo de ver el corto de animación de Pixar "La luna", dirigido por Enrico Casarosa, que acompañó a la proyección del largometraje "Brave" en las salas de cine. Y me he quedado con la boca abierta, como el niño protagonista. En pocos minutos se condensan ternura, cariño, orgullo y magia visual. La visión que nos ofrece de la luna es muy particular. Es la primera mirada a la luna que quiero ofreceros. 

La luna
La Luna
Imagen: www.pixar.com
Indagando he podido saber que la historia que nos cuenta Casarosa en el corto se basa en otra escrita por Italo Calvino titulada "La distancia de la luna" (que puedes leer siguiendo el enlace). La segunda mirada.

Y la tercera mirada, la de la humanidad en busca de conocimiento. Una mirada que puedes compartir con tus hijos/nietos/sobrinos o tus alumnos:

Durante muchos años los seres humanos sólo han podido observar y soñar con la misma vista de la luna. Aunque la luna tiene forma esférica, tarda lo mismo en rotar sobre sí misma que en dar una vuelta completa a la tierra, por lo que siempre nos ofrece una misma cara.

La llamada cara oculta de la luna ha permanecido desconocida, casi en su totalidad, hasta 1959. Ese año, la sonda soviética Luna 3 pudo tomar las primeras fotografías de esta cara, mostrando un tercio de su superficie invisible desde la tierra.

Nueve años después, en 1968, un ser humano pudo ver directamente la cara oculta por primera vez. El astronauta Willian Anders, de la misión Apolo 8, la describió así:  "parece un montón de arena en la que hayan jugado mis hijos durante un rato. Está toda magullada, sin definición, sólo un montón de bultos y agujeros"

Y es que las dos caras, o hemisferios, de la luna son muy diferentes. La cara visible tiene numerosos y grandes mares (mares lunares, sin agua claro está), mientras que la cara oculta está plagada de cráteres. En este vídeo puedes ver toda la superficie de la luna. Se ha hecho combinando digitalmente fotografías tomadas por la sonda espacial de la NASA Lunar Reconnaissance Orbiter, cuya misión es estudiar la luna. Comienza desde la cara familiar, la que podemos observar desde la tierra y gira hasta ofrecernos su cara más desconocida, para rotar de nuevo hacia su posición inicial. Veintinueve días condensados en menos de medio minuto.



He compartido contigo tres formas distintas de mirar la luna. Las dos primeras son miradas desde el arte (el cine y la literatura). Sobre la tercera me gustaría preguntarte:  ¿es la luna menos bella al observarla con una mirada científica?

jueves, 24 de octubre de 2013

La ciencia también se lee

Hoy 24 de octubre se celebra en España el Día de la Biblioteca. El cartel de este año incluye un dibujo de Andrés Rábago García 'El Roto' (Premio Nacional de Ilustración 2012) y una breve cuento de Laura Gallego García (escritora de literatura infantil y juvenil de éxito) que os transcribo a continuación:

Érase una vez un viajero que llegó desde un lugar lejano a un pueblo en el que no había libros. Se sentó a descansar en la plaza mayor y sacó de su morral un viejo volumen de cuentos. Cuando empezó a leer en voz alta, los niños, que nunca habían visto nada semejante, se sentaron a su alrededor para escucharlo.
El visitante relató historias que fascinaron a sus oyentes y les hicieron soñar con fantásticas aventuras en reinos maravillosos. Cuando terminó, cerró el libro para volver a guardarlo en su morral. Nadie se percató de que, al hacerlo, escapaban de entre sus páginas algunas palabras sueltas que cayeron al suelo. 
El viajero se marchó por donde había venido; tiempo después los habitantes del pueblo descubrieron el pequeño brote que elevaba sus temblorosas hojitas hacia el sol, en el lugar en el que habían caido las palabras perdidas. 
Todos asistieron asombrados al crecimiento de un árbol como no se había visto otro. Cuando llegó la primavera, el árbol exhibió con orgullo unas hermosas flores de pétalos de papel. Y, con los primeros compases del invierno, dio fruto por primera vez. 
Y sus ramas se cuajaron de libros de todas clases. Libros de aventuras, de misterio, de terror, de historias de tiempos pasados, presentes y futuros. Algunos se atrevieron a coger esos frutos, y había un sabio en el lugar que les enseño a leer para poder disfrutarlos. 
A veces, la brisa soplaba y sacudía las ramas del árbol. Las hojas de los libros se agitaban y dejaban caer nuevas palabras. Y pronto hubo más brotes por todo el pueblo; y en a penas un par de años, los árboles-libro estaban por todas partes. 
Se corrió la voz; muchos investigadores, curiosos y turistas pasaron por allí para conocer el lugar donde los libros crecían en los árboles. Los habitantes del pueblo leían sus páginas con fruición, y cuidaban cada brote con gran mimo. Y así iban recogiendo más y más historias con cada nueva cosecha de libros. 
Un día, los más sabios del lugar se reunieron y acordaron compartir su tesoro con el resto del mundo. Eligieron a un grupo de jóvenes y los animaron a escoger un libro del primer árbol que había crecido en el pueblo. Después, los enviaron a recorrer los caminos. 
Ellos se repartieron por el mundo, buscando un hogar para su preciada carga, y así, con el tiempo, cada uno dejó su libro en una biblioteca diferente. 
Y cuenta la historia que allí siguen todavía. Que hay algunas bibliotecas que guardan entre sus estantes un libro especial que deja caer palabras-semilla. Y que, si aterrizan en el lugar adecuado, cada una de esas palabras crecerá hasta convertirse en un árbol que dará como fruto nuevos libros. 
Nadie sabe en qué bibliotecas se encuentran estos libros maravillosos. Se desconoce también cuáles, de entre todos sus volúmenes, son los que proceden del pueblo donde los libros crecen en los árboles. Podría ser cualquier, y podría estar escondido en cualquier rincón de cualquier biblioteca del planeta. 
Animaos a entrar en ellas y a explorar sus estanterías, viajeros; porque quizá deis por casualidad con un libro cuyas palabras echen raíces en vuestro corazón y hagan crecer un magnífico árbol de historias cuyas semillas puedan llegar a cambiar el mundo.
¡Feliz día de la biblioteca! 
En este día en el que se celebra la lectura en los templos de los libros me gustaría revindicar la presencia de más libros divulgativos sobre la ciencia en las bibliotecas. Especialmente en las bibliotecas públicas (tanto para adultos como para niños y jóvenes) y en las bibliotecas escolares. Porque la ciencia no son solo experimentos, la ciencia también se lee.

Por eso me gustaría pediros que entre todos elaborásemos una lista de libros de divulgación altamente recomendables. Muchas bibliotecas públicas admiten sugerencias de sus lectores para futuras adquisiciones, y esta lista podría formar parte de las desideratas de muchas de ellas.

¿Cuál sería para ti ese libro especial capaz de dejar caer palabras-semilla sobre la ciencia? Si quieres compartirlo puedes hacerlo comentando esta entrada o enviándome un tuit a @RuedaInventos (indicando el título y nombre del autor).

Y para predicar con el ejemplo aquí va mi recomendación: La información de James Gleick.

jueves, 17 de octubre de 2013

De los neuromitos a la neuroeducación

Hace unos meses me llamó poderosamente la atención el título de una conferencia que iba a impartirse en el Parque de las Ciencias de Granada: "Neuroeducación: sólo se puede aprender aquello que se ama". Primero me atrapó el subtítulo porque desde mi experiencia parece cierto "sólo se puede aprender aquello que se ama...", o al menos lo aprendemos con más gusto y sin tener que tirar de nuestra fuerza de voluntad. Luego reparé en la primera palabra, neuroeducación. ¿Qué será esto?

Neuroeducación - Francisco Mora
Neuroeducación: solo se puede
aprender aquello que se ama.
Francisco Mora, Alianza Editorial
El conferenciante es ni más ni menos que Franciso Mora, neurocientífico y catedrático de la Universidad Complutense de Madrid, quien recientemente ha publicado un libro con el mismo título (que no he tenido todavía ocasión de leer).

La idea es atrayente: ¿pueden los avances de la neurociencia ayudar en la educación? Parece obvio que el conocer cómo funciona nuestro cerebro y nuestras motivaciones a la hora de aprender proporcionaría una base sólida sobre la que desarrollar nuevos modelos educativos. Sin embargo estamos todavía lejos de ese punto y queda mucho camino por recorrer.

Mientras, se han instalado en ciertos ámbitos educativos (me atrevería a decir que sobre todo a nivel de gestión empresarial) una serie de neuromitos que hacen flaco favor a este objetivo a largo plazo que es la neuroeducación. Estos mitos han surgido por varios motivos. Una teoría científica ya superada, una interpretación incorrecta de ciertos trabajos científicos o el etiquetado fraudulento de "científicamente probado". ¿Quién no ha oído afirmaciones como que sólo utilizamos el 10% de nuestro cerebro, o que aprendemos mejor la información que nos llega por nuestro canal preferido (auditivo, visual o cinestésico)? Puedes encontrar más neuromitos en este estudio sobre la prevalencia de los mismos entre los profesores de primaria y secundaria de Holanda y Gran Bretaña.

Gracias a los organizadores (el Parque de las Ciencias) he podido seguir la charla de Francisco Mora a través de Internet y quería compartirla con vosotros. Si queréis escuchar directamente a Francisco id al minuto 16 aproximadamente.



Si te interesa conocer este tema más a fondo, además del libro de Francisco Mora publicado por Alianza Editorial, te recomiendo leer la guía editada por la OCDE La comprensión del cerebro: El nacimiento de una ciencia del aprendizaje que está disponible gratuitamente a texto completo. De esta guía he extraído el siguiente párrafo:
"Muchas veces la naturaleza humana se conforma con -en incluso se deleita en- explicaciones rápidas, simples e inequívocas. Inevitablemente esto lleva a interpretaciones incorrectas, extrapolaciones cuestionables y, en términos generales, la génesis de ideas falsas".
Todos conocemos el cuento del pastor que gritaba continuamente ¡que viene el lobo! Sería una lástima que cuando llegue la verdadera neuroeducación nos encontrásemos una sociedad descreída y agotada por los neuromitos.

jueves, 10 de octubre de 2013

Las proteínas, los Umpa Lumpa de los seres vivos

Si hay una molécula protagonista en la biología del siglo XX esta es sin duda el ADN. Sin embargo yo les tengo más cariño a las proteínas, más numerosas y variadas (no en vano me paso todo el día trabajando con ellas). Para mi son como los Umpa Lumpa (o Oompa Loompa), los pequeños duendes que hacen funcionar la fábrica de chocolate de Willy Wonka. 

A pesar del cariño que las tengo no son muy conocidas entre los niños, ya que no las estudian hasta que llegan a bachillerato y sólo si eligen la modalidad de ciencias. Pues sinceramente, esto me entristece un poco. Así que me he decidido a remediarlo y voy a contaros hoy algo sobre ellas. Los Umpa Lumpa son todos muy parecidos pero en realidad son diferentes ¿verdad?. Pues las proteínas son justo al revés: parecen muy diferentes pero en realidad son similares

Las proteínas se parecen porque son todas como cadenas construidas con eslabones de 20 tipos. El número total de eslabones que componen una proteína es muy variable: desde unos pocos hasta miles de ellos, pero únicamente de 20 tipos distintos. A estas cadenas las llamamos secuencias, y cuando trabajamos con ellas en el ordenador las escribimos como si fueran una palabra, utilizando 20 letras mayúsculas distintas (una por cada tipo de eslabón o aminoácido). 

Por ejemplo, la haditoxina es una proteína con 65 eslabones. Se trata de una toxina de la cobra real (Ophiophagus hannah). Esta proteína es responsable, junto con otras sustancias del veneno de la cobra, del bloqueo muscular que experimentan sus presas al ser mordidas por esta. Su secuencia es como sigue:

TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ

Sencillo ¿verdad? Un eslabón (o aminoácido) detrás de otro.

A su vez las proteínas son diferentes porque, aunque podamos pensar en ellas como cadenas de aminoácidos, en realidad estos se organizan en el espacio. ¡Las proteínas son siempre 3D!. Por eso la mayor parte de ellas tiene una forma característica. En la jerga científica decimos que las proteínas se pliegan. Retomando el ejemplo, conocemos la estructura 3D de la haditoxina de la cobra real y podemos representarla en el ordenador que nos la muestra así.
Estructura 3D de la haditoxina, una de las proteínas
que forma parte del veneno de la cobra real.
Más información en Protein Data Bank

Bonita y compleja a la vez ¿no crees? Puedes seguir el trazado de la cadena principal recorriendo la cinta coloreada (desde el extremo izquierdo al derecho siguiendo el rojo, pasando por el naranja, amarillo, verde, azul celeste y finalizando en la flecha añil).

¿Quieres ver qué formas tan distintas pueden llegar a tener las proteínas? En esta última imagen aparecen sólo algunas de las que conocemos su estructura 3D. Como hay proteínas con estructuras muy diferentes pueden hacer todo tipo de funciones en los seres vivos (igual que los Umpa Lumpa en la fábrica de chocolate). ¡No vayas a creer que todas las proteínas son veneno! Pero ésta es otra historia y te la contaré en otro momento.
Estructuras 3D de algunas proteínas.
Imagen de: Protein Data Bank.
Puedes descargar este poster en PDF
Esta entrada participa en el XXVIII Carnaval de Química organizado por Flagellum (@3DCiencia)
Esta entrada participa en el XXVI Carnaval de Biología (edición especial junior), organizado por La Rueda de los Inventos

jueves, 3 de octubre de 2013

El verdadero "campo de medusas"

De todos los niños es conocida la afición de Bob Esponja y su amigo Patricio por entretenerse jugando en el campo de medusas con sus atrapa-mariposas.

Bob Esponja en el campo de medusas
Bob Esponja en el campo de medusas
Imagen: www.iwallscreen.com
Viendo el primer capítulo de la serie de divulgación científica de la BBC "Wonders of life" (Maravillas de la vida) he llegado a conocer que, aunque increíble que parezca, el campo de medusas existe realmente (o al menos es lo más parecido en lo que yo pueda pensar). Se trata del conocido como "lago de las medusas", situado en Palau, un archipiélago del Océano Pacífico.

Este lago de agua salada está ecológicamente aislado del resto del océano y se encuentra plagado de unas medusas únicas (sólo se han encontrado aquí): las medusas doradas.

Estas medusas con especiales porque no pican tanto como las medusas a las que estamos acostumbrados a encontrar en la playa y porque viven en constate migración huyendo de sus depredadores (las anémonas) y buscando la luz del sol (sí, como las plantas).

Submarinista rodeado por medusas doradas.
Imagen: www.divetime.com
¿Por qué buscan el sol? Pues porque viven en estrecha convivencia con unas algas unicelulares, las zooxantelas. Este tipo de relación, que se llama simbiosis, permite a la medusa obtener la mayor parte de la energía que necesita para vivir a través de la fotosíntesis (indirectamente claro está). Las algas embebidas en las células de las medusas doradas sí son capaces de convertir la energía del sol en energía química, sintetizando moléculas complejas como la glucosa que servirá de alimento para las células de las medusas.

Ésta relación simbiótica con las algas explica en parte por qué las medusas doradas no tienen prácticamente tentáculos, ya que no necesitan buscar el alimento de la misma manera que si vivieran en el océano abierto.

En 2012 las Islas Rocosas donde se encuentra el lago de las medusas fue declarado Patrimonio de la Humanidad por la UNESCO. Si te animas a ir a verlo, pueden realizarse visitas turísticas.

Esta entrada participa en el XXVI Carnaval de Biología (edición especial junior), organizado por La Rueda de los Inventos.

martes, 1 de octubre de 2013

Anuncio del XXVI Carnaval de Biología

Tengo el honor de anunciar que a partir de hoy mismo,  y hasta el próximo día 31 de octubre de 2013, La Rueda de los Inventos será el blog anfintrión del XXVI Carnaval de Biología, también conocido como biocarnaval.

El Carnaval de Biología es, al igual que otros Carnavales (Física, Química, Geología...), un encuentro virtual en la red, que se organiza mensualmente y de manera itinerante. Cada edición está coordinada y acogida por un blog y cuenta con la participación voluntaria de otros muchos.

Como sabéis La Rueda de los Inventos está dedicada a la ciencia y la tecnología para niños (y niñas claro está). Así que no voy a proponer un tema concreto para las entradas que participen, pero sí un tono, el de la biología para todos los públicos. Así que esta vigésimo sexta edición será una edición especial, el Carnaval de Biología Júnior.

Biocarnaval Junior

Os invito a participar con vuestras entradas en forma de cuentos, historias, experimentos, vídeos, reflexiones o cualquier otro formato que se os ocurra que traten un aspecto de la Biología que pueda ser interesante para los niños. Las temáticas menos tratadas en los colegios son especialmente bienvenidas (en este sentido os animo a leer mi entrada sobre Niños, ciencia y aprendizaje informal).

Como en ediciones anteriores, se admitirán todo tipo de participaciones. Si la tuya encaja en la sección Júnior, por favor indícanoslo para marcarla como tal. También puedes colaborar leyendo y comentando las entradas participantes, así como difundiendo esta XXVI edición del carnaval.

Por lo demás, las normas de participación para esta edición serán las de siempre:
  • Participación libre, desde el propio blog o como autor invitado en el blog de un amigo, familiar, etc., también solicitándolo al anfitrión de turno del biocarnaval.
  • Cada mes el blog anfitrión anunciará el inicio del carnaval indicando la fecha de comienzo (se recomienda que sea la misma que la del anuncio y la fecha de fin del mismo, preferiblemente a finales de cada mes).
  • La temática será libre pudiendo ser de cualquiera de los muchos campos dentro de la biología: evolución, botánica, zoología, microbiología, bioquímica, genética, etc. Sin embargo, el anfitrión puede proponer un tema concreto sobre el que los participantes pueden escribir, dibujar, cantar, o lo que tengan pensado.
  • Cada entrada (post) publicada deberá indicar que participa en la n-Edición del Carnaval de Biología citando y enlazando al blog organizador. Tenéis dos posibles formas de avisar, directamente al blog anfitrión dejando un comentario en esta entrada o al twitter del carnaval @biocarnaval.
  • Cada organizador puede proponer mejoras y cambios para el biocarnaval.

Aquí puedes encontrar una lista de las anteriores ediciones:
Parece que la edición especial júnior del biocarnaval era casi inevitable después del tema propuesto en la última edición...
XXVI Carnaval de Biología. Especial Júnior. Varios autores. Organizado, en esta edición por La Rueda de los Inventos
¡Os animo a participar, leer, comentar y difundir desde ahora mismo!


Aquí aparecerán las contribuciones de esta edición según vayan llegando:

Esta XXVI edición del Carnaval de Biología ya ha terminado. Puedes encontrar un resumen de la edición aquí. ¡Hasta pronto!

Licencia CC

Licencia Creative Commons
La Rueda de los Inventos por Monica Chagoyen se encuentra bajo una Licencia Creative Commons Atribución 3.0 Unported. Citar: www.laruedadelosinventos.org.
Related Posts Plugin for WordPress, Blogger...