jueves, 10 de octubre de 2013

Las proteínas, los Umpa Lumpa de los seres vivos

Si hay una molécula protagonista en la biología del siglo XX esta es sin duda el ADN. Sin embargo yo les tengo más cariño a las proteínas, más numerosas y variadas (no en vano me paso todo el día trabajando con ellas). Para mi son como los Umpa Lumpa (o Oompa Loompa), los pequeños duendes que hacen funcionar la fábrica de chocolate de Willy Wonka. 

A pesar del cariño que las tengo no son muy conocidas entre los niños, ya que no las estudian hasta que llegan a bachillerato y sólo si eligen la modalidad de ciencias. Pues sinceramente, esto me entristece un poco. Así que me he decidido a remediarlo y voy a contaros hoy algo sobre ellas. Los Umpa Lumpa son todos muy parecidos pero en realidad son diferentes ¿verdad?. Pues las proteínas son justo al revés: parecen muy diferentes pero en realidad son similares

Las proteínas se parecen porque son todas como cadenas construidas con eslabones de 20 tipos. El número total de eslabones que componen una proteína es muy variable: desde unos pocos hasta miles de ellos, pero únicamente de 20 tipos distintos. A estas cadenas las llamamos secuencias, y cuando trabajamos con ellas en el ordenador las escribimos como si fueran una palabra, utilizando 20 letras mayúsculas distintas (una por cada tipo de eslabón o aminoácido). 

Por ejemplo, la haditoxina es una proteína con 65 eslabones. Se trata de una toxina de la cobra real (Ophiophagus hannah). Esta proteína es responsable, junto con otras sustancias del veneno de la cobra, del bloqueo muscular que experimentan sus presas al ser mordidas por esta. Su secuencia es como sigue:

TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ

Sencillo ¿verdad? Un eslabón (o aminoácido) detrás de otro.

A su vez las proteínas son diferentes porque, aunque podamos pensar en ellas como cadenas de aminoácidos, en realidad estos se organizan en el espacio. ¡Las proteínas son siempre 3D!. Por eso la mayor parte de ellas tiene una forma característica. En la jerga científica decimos que las proteínas se pliegan. Retomando el ejemplo, conocemos la estructura 3D de la haditoxina de la cobra real y podemos representarla en el ordenador que nos la muestra así.
Estructura 3D de la haditoxina, una de las proteínas
que forma parte del veneno de la cobra real.
Más información en Protein Data Bank

Bonita y compleja a la vez ¿no crees? Puedes seguir el trazado de la cadena principal recorriendo la cinta coloreada (desde el extremo izquierdo al derecho siguiendo el rojo, pasando por el naranja, amarillo, verde, azul celeste y finalizando en la flecha añil).

¿Quieres ver qué formas tan distintas pueden llegar a tener las proteínas? En esta última imagen aparecen sólo algunas de las que conocemos su estructura 3D. Como hay proteínas con estructuras muy diferentes pueden hacer todo tipo de funciones en los seres vivos (igual que los Umpa Lumpa en la fábrica de chocolate). ¡No vayas a creer que todas las proteínas son veneno! Pero ésta es otra historia y te la contaré en otro momento.
Estructuras 3D de algunas proteínas.
Imagen de: Protein Data Bank.
Puedes descargar este poster en PDF
Esta entrada participa en el XXVIII Carnaval de Química organizado por Flagellum (@3DCiencia)
Esta entrada participa en el XXVI Carnaval de Biología (edición especial junior), organizado por La Rueda de los Inventos

2 comentarios:

  1. He usado este blog con alumnos bilingues. Gracias Monica!

    ResponderEliminar
    Respuestas
    1. Gracias María por tu comentario. Me alegra muchísimo saber que el blog está siendo de utilidad en tus clases

      Eliminar

Licencia CC

Licencia Creative Commons
La Rueda de los Inventos por Monica Chagoyen se encuentra bajo una Licencia Creative Commons Atribución 3.0 Unported. Citar: www.laruedadelosinventos.org.
Related Posts Plugin for WordPress, Blogger...