jueves, 26 de diciembre de 2013

La ciencia y los niños en el 2013

Me gustaría cerrar el año haciendo un recuento de lo que ha supuesto para mí La Rueda de los Inventos. Por eso quiero compartir con vosotros aquello que más os ha gustado del blog durante el año 2013.

Chemistree de @RyanPhamylton
Una iniciativa navideña en twitter
de @ChemistryWorld
Las reseñas de libros de divulgación  infantiles y juveniles más consultadas: uno de ciencia Cuentos de microbios, de Arthur Kornberg; y otro de tecnología: Atlas básico de tecnología, de Néstor Navarrete

Dos lugares especiales y muy concurridos en Internet: el blog de un profe sevillano Manuel Díaz Escalera Experimentos caseros en FQ experimentos, y el de Clara Grima y Raquel García-Uldemollins sobre Matemáticas Mati y sus mateaventuras.

Dos formas distintas de acercar la ciencia a los niños: Niños, ciencia y aprendizaje informal, o la ciencia fuera del cole; y La ciencia es para todos incluidos los niños, o cómo Beau Lotto y un grupo de escolares llegaron a publicar en una revista científica.

En el mes de octubre albergamos la XXVI edición del Carnaval de Biología. El blog participó en esta edición, entre otras, con la siguiente entrada que llegó hasta MenéameLas proteínas, los Umpa Lumpa de los seres vivos

La importancia de descubrir la ciencia a través de los juegos: De mayor quiero ser científica, la historia de Dorothy Crowfoot Hodgkin, una de las cuatro mujeres ganadoras del Nobel de Química; y Science4you: juguetes científicos y algo más, la apuesta de una empresa portuguesa especializada en juguetes científicos.

Los Museos de Ciencia y Tecnología, con las reseñas de dos museos que he tenido la suerte de visitar y que me sorprendieron gratamente: el humilde encanto del Museo de la Minería y la Industria (MUMI), en Asturias; y el espectacular y casi inabarcable Museo Alemán de la Técnica, en Berlín (Alemania).

Y para finalizar, las entradas más retuiteadas: ALMA y el Principito, sobre el gran telescopio construido en Chile, y De los neuromitos a la neuroeducación ¿puede la neurociencia ayudar en la educación?

¡Feliz Año Nuevo! Y mi deseo especial para el año próximo 2014: que venga cargado de oportunidades de acercar la ciencia y la tecnología a los niños.

jueves, 19 de diciembre de 2013

Experimentos para cada estación

Quedan muy pocos días para que finalice el otoño y demos la bienvenida al invierno. Tiempo frío que nos hace pasar más tiempo en casa, y nos da la oportunidad de hacer más actividades caseras con los niños.

Experimentos para cada día del invierno.
Un libro de Anita van Saan
Si lo que quieres es pasar un rato divertido en casa haciendo ciencia tienes muchas posibilidades, entre las que hoy te recomiendo, hacer experimentos. Si no se te ocurren experimentos para hacer puedes encontrar varios en el libro Experimentos para cada día del invierno. En él su autora, Anita van Saan, propone 84 experimentos sencillos. Están relacionados con cinco temas distintos: el frío, el sonido, el calor, las matemáticas y los regalos.

En todos los experimentos Anita nos indica qué necesitamos y cómo tenemos que hacerlos. Luego nos pregunta ¿qué ocurre? y ¿cómo se explica eso? y nos ayuda a contestarlo. Algunos solo podremos hacerlos en invierno y cuando tengamos acceso a la nieve.

En la misma colección Anita nos propone también experimentos para cada día de la primavera, del verano y del otoño. Lamentablemente parece que los libros de la serie "Experimentos para cada día de ..." están descatalogados. Quizá puedas conseguirlos de segunda mano, o en una biblioteca pública.

Así que, como el libro me ha gustado he buscado más libros de la misma autra y he encontrado éste que sí está actualmente disponible, y publicado también por Oniro (a partir de 12 años):

menudos-inventos_9788497545129.jpg
Anita van Saan
¡Descubre cómo surgieron los inventos más revolucionarios y las ideas más explosivas de la historia!

Experimentos para cada día del invierno. De Anita van Saan, publicado por Oniro (para niños y niñas a partir de 10 años)

Lo mejor: La propuesta de experimentos sencillos que podemos hacer en casa

Lo peor: El libro está actualmente descatalogado


jueves, 12 de diciembre de 2013

Un juego para aprender a programar

Parece que está de moda eso de que los niños aprendan a programar. Por lo menos son varias las plataformas disponibles para que así sea (como Scratch, del Massachusetts Institute of Technology- MIT).

Yo no he probado ninguna de ellas, pero leyendo sobre el tema se me ocurrió que ya había visto hace mucho tiempo, en mi infancia, un juego que era lo más parecido a programar sin programar. Algo así como el juego del teléfono estropeado, que nos permite entender de una manera divertida e intuitiva qué es eso del ruido en las comunicaciones.

Luis Ricardo, interpretado por José Carabias.
Imagen: www.yofuiaegb.com
El juego en cuestión formaba parte del programa infantil "Un globo, dos globos, tres globos", en la época en que lo presentaba María Luisa Seco (¡qué tardes de merienda delante de la tele!). El protagonista: Luis Ricardo, un monstruito tipo Frankenstein interpretado por el actor José Carabias. Y las reglas sencillas, el niño concursante tenía que conseguir que Luis Ricardo hiciera algo, por ejemplo servir agua en un vaso. Para eso iba dándole órdenes a Luis Ricardo y hacía que las ejecutara a la voz de "Luis Ricardo cantidubi dubi dubi, cantidubi dubi da ¡ya!".

Lo divertido del juego es que José Carabias era muy pillo, y a la menor imprecisión de la orden que le daban hacía de las suyas. Por ejemplo, mira cómo en este vídeo, al pedirle que se dé la vuelta, interpreta la orden a su manera y da una voltereta en el suelo:



De esta forma Luis Ricardo ponía las cosas difíciles a los concursantes. Y los niños tenían que agudizar su ingenio para dividir la tarea a realizar en sub-tareas más sencillas (como acercase a la mesa, coger la jarra, acercar la jarra al vaso, volcar la jarra en el vaso) y darle a Luis Ricardo órdenes precisas evitando todas las ambigüedades posibles. Por ejemplo si sólo ordenan "vuelca la jarra en el vaso", lo más probable es que Luis Ricardo volteara brúscamente la jarra derramando de golpe todo el agua. Así que lo más apropiado sería pedirle que lo hiciera lentamente.

Pasaron unos cuantos años desde que me entretuviera con este concurso de la tele hasta que comencé a programar, primero en actividades extraescolares y luego en la universidad. Ahora, tras haber dedicado gran parte de mis horas de trabajo a la programación y con unas cuantas líneas de código a mis espaldas no se me ocurre una manera más sencilla y lúdica de enseñar a un niño a programar que jugar a "Luis Ricardo"

Porque lo más importante para aprender a programar no es aprender a escribir código, es decir, aprender el idioma que Luis Ricardo entiende (que yo sepa todos los concursantes sabían español). Lo importante es aprender a pensar como Luis Ricardo, que es algo cortito y literal (sí, como los ordenadores), y darle las órdenes precisas de una manera adecuada para que haga lo que nosotros queremos.

Luis Ricardo cantidubi dubi dubi, cantidubi dubi da ¡ya!. Un juego para enseñar a los niños a programar. 

Nota: El papel de Luis Ricardo debe ser interpretado por un adulto con suficiente picardía.


jueves, 28 de noviembre de 2013

Inventos cotidianos para todos

El sábado pasado tuve la oportunidad de ver la exposición Héroes ocultos, en Alcalá de Henares. Se trata de una exposición itinerante creada por el Vitra Design Museum alemán, y que podemos ver en España gracias a la Fundación la Caixa. ¿Quiénes son los héroes ocultos? Un conjunto de inventos de uso cotidiano que todos conocemos.

Inventos de Héroes ocultos
Algunos de los inventos de "Héroes ocultos"
Entre los inventos hay muchos cotidianos y cercanos a los niños: las piezas de Lego, el lápiz, el bolígrafo, el velcro (que tanto les facilita la vida a la hora de abrocharse las zapatillas), la cremallera, la tirita... Y muchas historias sobre sus inventores, cómo y por qué crearon el objeto. Algunas de ellas también relacionadas con los niños o con la infancia de sus inventores. Por ejemplo ¿sabías que el inventor del bolígrafo, László Bíró, argentino de origen húngaro, se inspiró viendo a unos niños que jugaban a las canicas? ¿o que el gran éxito de las tiritas se debe a que se regalaron a los boy-scouts en Estados Unidos después de un primer fracaso comercial?. 

En la página de EduCaixa están disponibles varios documentos que pueden ayudarnos en la visita (sobre todo si vas con niños y no sigues la visita guiada): un dossier complementario a la exposición, y tres itinerarios (tecnológicoartístico y social) que dan pautas para trabajar en clase.

Además existe una exposición virtual que puedes visitar en internet www.hidden-heroes.net disponible en español. La versión virtual incluye más inventos que la real. Selecciona primero los objetos que quieres ver, y crea tu propia exposición. Pero a cambio no verás algunos objetos que se han incorporado a la colección que han traído a nuestro país, y que son inventos genuinamente españoles como la fregona o la aceitera Marquina, o están muy arraigados en España como el botijo y el abanico.

Algunos de los inventos que podemos ver en la exposición han sido mejorados con el paso del tiempo, y otros permanecen prácticamente inalterables desde que se inventaron. Muchos, a pesar de su uso cotidiano, se han utilizado para crear obras de arte (mira por ejemplo qué puede hacer Mark Khaisman con la cinta de embalaje). Pero todos tienen algo en común: nos han hecho la vida mucho más fácil. 
Héroes ocultos del Vitra Design Museum. Exposición itinerante organizada por la Fundación la Caixa.

jueves, 21 de noviembre de 2013

Más que una princesa

Esta semana me ha llegado por varias fuentes a través de Twitter el anuncio de Goldie Blox, una empresa estadounidense que fabrica y comercializa juguetes de construcción específicamente dirigidos a las niñas. El objetivo de su fundadora y CEO, Debbie Sterling, es inspirar la pasión por la ingeniería entre las niñas.



He leído todo tipo de opiniones sobre la filosofía de la empresa y sobre el vídeo. Lo primero que me viene a la cabeza después de verlo es (citando al famoso Mario Vaquerizo): "Me da igual. ¡Me encanta!". ¿Discriminación positiva? ¿Juguetes sexistas? ¿Estrategia comercial? "Me da igual. ¡Me encanta!"

¿Y por qué me gusta tanto? Porque igual que las niñas del siguiente anuncio, también de Goldie Blox, me entran ganas de gritar y llevarme por delante con una apisonadora el pasillo rosa de las jugueterías... (que por otra parte no recuerdo fuera tan rosa y almibarado en mis años mozos). Que conste que a mí me encantaba jugar con muñecas y cocinitas, pero soy pro Nancy y anti Barbie.


[ Nota: El anuncio original ha sido retirado de YouTube]

Sin embargo entiendo que para gustos, los colores y que lo mejor en esta vida es la diversidad y la posibilidad de elegir. Por eso dejaré tranquilo el pasillo rosa. Eso sí, por este mismo motivo, aplaudo a Debbie Sterling por su iniciativa y a los creadores de su campaña publicitaria. Voy a ver si tienen tallas para adultos de sus camisetas para encargarme una. Su lema: more than just a princess (más que una princesa). 

 Goldie Blox. Juguetes de construcción para "más que princesas".

jueves, 14 de noviembre de 2013

Solo sé que no sé nada

Hay veces que no puedes escapar de una idea que te ronda la cabeza. Hay otras, sin embargo, que parece que te persiguen una y otra vez, aunque quieras olvidarlas. Es de una de éstas últimas de las que quiero hablaros hoy.

Más que una idea es una señal que me habla desde el corcho de uno de los pasillos del centro donde trabajo. Más en concreto, es un artículo de opinión publicado en la revista Journal of Cell Science y que alguien colgó con una chincheta hace tiempo en el citado corcho. El artículo se titula La importancia de la estupidez en la investigación científica y está escrito por Martin A. Schwartz.

Corcho en el pasillo
El artículo del corcho me llama
continuamente la atención sobre él
Nos cuenta Martin que se encontró con una amiga que hacía años que no veía. Ella había dejado colgada la ciencia durante su doctorado y después de estudiar derecho era una abogada de éxito. ¿Que por qué había dejado la investigación? Pues su respuesta fue que le hacía sentir estúpida.

Y pensando sobre ello Martin se dio cuenta que a él también le hacía sentir estúpido, pero que se había acostumbrado a ello. Estudiar una disciplina científica e investigar son dos cosas totalmente diferentes. Durante la etapa como estudiante, si eres bueno aprendiendo tienes la sensación de que sabes mucho. Sin embargo, como dice Martin, la investigación es inmersión en lo desconocido [...] La ciencia implica enfrentarnos a nuestra 'absoluta estupidez'.

No puedo estar más de acuerdo con Martin. Mientras que el reconocimiento de la propia estupidez puede resultar doloroso a muchas personas, es en realidad una experiencia liberadora. En la investigación científica, la máxima de Sócrates 'solo sé que no sé nada' no es una cuestión de falsa humildad, sino de profunda realidad. Por eso es importante realizar pronto la gran transición: de aprender lo que otra gente ha descubierto a hacer nuestros propios descubrimientos. Cuanto más cómodos nos encontremos con ser estúpidos más nos internaremos en lo desconocido y con mayor probabilidad haremos grandes descubrimientos.
The importance of stupidity in scientific research. Por Martin A. Schwartz. Journal of Cell Science 2008 121:1771
Ahora yo me pregunto si no deberíamos hacer esta transición mucho antes, ya desde la escuela. Sólo cuando te reconoces ignorante estás en disposición de aprender. Porque en la ciencia son mucho más importantes las preguntas que las respuestas. Y los niños son preguntones por naturaleza. ¿No sería mucho más rico en su aprendizaje centrarnos más en las preguntas, para hacérselas relevantes, y no tanto en las respuestas? Una vez despertada la sed por saber, el camino hasta la respuesta es mucho más interesante...

Nota: Esta entrada participa en el XXVII Carnaval de Biología organizado por La aventura de la ciencia

jueves, 7 de noviembre de 2013

Science4you: juguetes científicos y algo más

Quería retrasar esta entrada lo máximo posible para publicarla cerca de las Navidades, más en concreto cerca de ese periodo de locura anterior a Papá Noel y los Reyes Magos. No sé qué es más preocupante: el adelanto de los anuncios de turrones que sufrimos cada año o el de los catálogos de juguetes. Más tiempo para ganar calorías y para llenar los folletos con marcas y me-lo-pido

Juguetes científicos de Science4you
Pues esta vez la que se adelanta soy yo, para pillaros desprevenidos y adelantarme al momento en el que todavía es posible dirigir de alguna manera esa lista de deseos y descripción de bondades. Al fin y al cabo siempre estamos en busca de regalos originales. Pues ¿por qué no pedir juguetes científicos este año para variar un poco?

Mi primera propuesta son los juguetes de Science4you. Una empresa muy joven que nació en nuestro país vecino (Portugal) y cuya filial española está cerquita de mi centro de trabajo. Así que he tenido oportunidad de hablar con ellos sobre sus juguetes y su proyecto empresarial. 

Lo que más me ha gustado para atreverme a recomendarlos es que están especializados en juguetes científicos y que ofrecen algo más. Porque cada juguete es una puerta a la ciencia y a conocer más sobre ella. Cada juego que compres va a ir acompañado de:
  • un mini-libro explicativo muy completo, que permite a los niños profundizar en el tema científico del que tratan
  • una propuesta de experimentos, para observar, pensar y sacar conclusiones, en definitiva acercarse a los procesos científicos
  • entradas de regalo para los principales museos de ciencia, para seguir explorando en otros entornos de aprendizaje
Su catálogo de juguetes es muy amplio y variado: desde juegos sobre energías renovables (como una casa solar o un reloj ecológico que funciona con naranjas o limones), hasta kits de de análisis (huellas dactilares, química), pasando por puzles o juegos de preguntas y respuestas.

Si quieres ayudar a Papá Noel y a los Reyes Magos aquí encontrarás dónde comprar los juguetes científicos Science4you y su tienda online. Además de fabricar juguetes, Science4you organiza actividades sobre ciencia para niños y jóvenes (hasta 14 años).

Como ha señalado Francisco Mora (neurocientífico) en su conferencia "Neuroeducación: sólo se puede aprender aquello que se ama" (que puedes ver en mi entrada De los neuromitos a la neuroeducación):
"El juego es el disfraz con el que la naturaleza ha vestido los procesos de aprendizaje y memoria".
Si en cualquier caso lo tuyo no son los juguetes científicos, pero quieres regalarles ciencia puedes echar un vistazo a los libros de divulgación que he reseñado hasta ahora, o planear un día con ellos en un museo de ciencia.

jueves, 31 de octubre de 2013

Tres miradas a la luna

Acabo de ver el corto de animación de Pixar "La luna", dirigido por Enrico Casarosa, que acompañó a la proyección del largometraje "Brave" en las salas de cine. Y me he quedado con la boca abierta, como el niño protagonista. En pocos minutos se condensan ternura, cariño, orgullo y magia visual. La visión que nos ofrece de la luna es muy particular. Es la primera mirada a la luna que quiero ofreceros. 

La luna
La Luna
Imagen: www.pixar.com
Indagando he podido saber que la historia que nos cuenta Casarosa en el corto se basa en otra escrita por Italo Calvino titulada "La distancia de la luna" (que puedes leer siguiendo el enlace). La segunda mirada.

Y la tercera mirada, la de la humanidad en busca de conocimiento. Una mirada que puedes compartir con tus hijos/nietos/sobrinos o tus alumnos:

Durante muchos años los seres humanos sólo han podido observar y soñar con la misma vista de la luna. Aunque la luna tiene forma esférica, tarda lo mismo en rotar sobre sí misma que en dar una vuelta completa a la tierra, por lo que siempre nos ofrece una misma cara.

La llamada cara oculta de la luna ha permanecido desconocida, casi en su totalidad, hasta 1959. Ese año, la sonda soviética Luna 3 pudo tomar las primeras fotografías de esta cara, mostrando un tercio de su superficie invisible desde la tierra.

Nueve años después, en 1968, un ser humano pudo ver directamente la cara oculta por primera vez. El astronauta Willian Anders, de la misión Apolo 8, la describió así:  "parece un montón de arena en la que hayan jugado mis hijos durante un rato. Está toda magullada, sin definición, sólo un montón de bultos y agujeros"

Y es que las dos caras, o hemisferios, de la luna son muy diferentes. La cara visible tiene numerosos y grandes mares (mares lunares, sin agua claro está), mientras que la cara oculta está plagada de cráteres. En este vídeo puedes ver toda la superficie de la luna. Se ha hecho combinando digitalmente fotografías tomadas por la sonda espacial de la NASA Lunar Reconnaissance Orbiter, cuya misión es estudiar la luna. Comienza desde la cara familiar, la que podemos observar desde la tierra y gira hasta ofrecernos su cara más desconocida, para rotar de nuevo hacia su posición inicial. Veintinueve días condensados en menos de medio minuto.



He compartido contigo tres formas distintas de mirar la luna. Las dos primeras son miradas desde el arte (el cine y la literatura). Sobre la tercera me gustaría preguntarte:  ¿es la luna menos bella al observarla con una mirada científica?

jueves, 24 de octubre de 2013

La ciencia también se lee

Hoy 24 de octubre se celebra en España el Día de la Biblioteca. El cartel de este año incluye un dibujo de Andrés Rábago García 'El Roto' (Premio Nacional de Ilustración 2012) y una breve cuento de Laura Gallego García (escritora de literatura infantil y juvenil de éxito) que os transcribo a continuación:

Érase una vez un viajero que llegó desde un lugar lejano a un pueblo en el que no había libros. Se sentó a descansar en la plaza mayor y sacó de su morral un viejo volumen de cuentos. Cuando empezó a leer en voz alta, los niños, que nunca habían visto nada semejante, se sentaron a su alrededor para escucharlo.
El visitante relató historias que fascinaron a sus oyentes y les hicieron soñar con fantásticas aventuras en reinos maravillosos. Cuando terminó, cerró el libro para volver a guardarlo en su morral. Nadie se percató de que, al hacerlo, escapaban de entre sus páginas algunas palabras sueltas que cayeron al suelo. 
El viajero se marchó por donde había venido; tiempo después los habitantes del pueblo descubrieron el pequeño brote que elevaba sus temblorosas hojitas hacia el sol, en el lugar en el que habían caido las palabras perdidas. 
Todos asistieron asombrados al crecimiento de un árbol como no se había visto otro. Cuando llegó la primavera, el árbol exhibió con orgullo unas hermosas flores de pétalos de papel. Y, con los primeros compases del invierno, dio fruto por primera vez. 
Y sus ramas se cuajaron de libros de todas clases. Libros de aventuras, de misterio, de terror, de historias de tiempos pasados, presentes y futuros. Algunos se atrevieron a coger esos frutos, y había un sabio en el lugar que les enseño a leer para poder disfrutarlos. 
A veces, la brisa soplaba y sacudía las ramas del árbol. Las hojas de los libros se agitaban y dejaban caer nuevas palabras. Y pronto hubo más brotes por todo el pueblo; y en a penas un par de años, los árboles-libro estaban por todas partes. 
Se corrió la voz; muchos investigadores, curiosos y turistas pasaron por allí para conocer el lugar donde los libros crecían en los árboles. Los habitantes del pueblo leían sus páginas con fruición, y cuidaban cada brote con gran mimo. Y así iban recogiendo más y más historias con cada nueva cosecha de libros. 
Un día, los más sabios del lugar se reunieron y acordaron compartir su tesoro con el resto del mundo. Eligieron a un grupo de jóvenes y los animaron a escoger un libro del primer árbol que había crecido en el pueblo. Después, los enviaron a recorrer los caminos. 
Ellos se repartieron por el mundo, buscando un hogar para su preciada carga, y así, con el tiempo, cada uno dejó su libro en una biblioteca diferente. 
Y cuenta la historia que allí siguen todavía. Que hay algunas bibliotecas que guardan entre sus estantes un libro especial que deja caer palabras-semilla. Y que, si aterrizan en el lugar adecuado, cada una de esas palabras crecerá hasta convertirse en un árbol que dará como fruto nuevos libros. 
Nadie sabe en qué bibliotecas se encuentran estos libros maravillosos. Se desconoce también cuáles, de entre todos sus volúmenes, son los que proceden del pueblo donde los libros crecen en los árboles. Podría ser cualquier, y podría estar escondido en cualquier rincón de cualquier biblioteca del planeta. 
Animaos a entrar en ellas y a explorar sus estanterías, viajeros; porque quizá deis por casualidad con un libro cuyas palabras echen raíces en vuestro corazón y hagan crecer un magnífico árbol de historias cuyas semillas puedan llegar a cambiar el mundo.
¡Feliz día de la biblioteca! 
En este día en el que se celebra la lectura en los templos de los libros me gustaría revindicar la presencia de más libros divulgativos sobre la ciencia en las bibliotecas. Especialmente en las bibliotecas públicas (tanto para adultos como para niños y jóvenes) y en las bibliotecas escolares. Porque la ciencia no son solo experimentos, la ciencia también se lee.

Por eso me gustaría pediros que entre todos elaborásemos una lista de libros de divulgación altamente recomendables. Muchas bibliotecas públicas admiten sugerencias de sus lectores para futuras adquisiciones, y esta lista podría formar parte de las desideratas de muchas de ellas.

¿Cuál sería para ti ese libro especial capaz de dejar caer palabras-semilla sobre la ciencia? Si quieres compartirlo puedes hacerlo comentando esta entrada o enviándome un tuit a @RuedaInventos (indicando el título y nombre del autor).

Y para predicar con el ejemplo aquí va mi recomendación: La información de James Gleick.

jueves, 17 de octubre de 2013

De los neuromitos a la neuroeducación

Hace unos meses me llamó poderosamente la atención el título de una conferencia que iba a impartirse en el Parque de las Ciencias de Granada: "Neuroeducación: sólo se puede aprender aquello que se ama". Primero me atrapó el subtítulo porque desde mi experiencia parece cierto "sólo se puede aprender aquello que se ama...", o al menos lo aprendemos con más gusto y sin tener que tirar de nuestra fuerza de voluntad. Luego reparé en la primera palabra, neuroeducación. ¿Qué será esto?

Neuroeducación - Francisco Mora
Neuroeducación: solo se puede
aprender aquello que se ama.
Francisco Mora, Alianza Editorial
El conferenciante es ni más ni menos que Franciso Mora, neurocientífico y catedrático de la Universidad Complutense de Madrid, quien recientemente ha publicado un libro con el mismo título (que no he tenido todavía ocasión de leer).

La idea es atrayente: ¿pueden los avances de la neurociencia ayudar en la educación? Parece obvio que el conocer cómo funciona nuestro cerebro y nuestras motivaciones a la hora de aprender proporcionaría una base sólida sobre la que desarrollar nuevos modelos educativos. Sin embargo estamos todavía lejos de ese punto y queda mucho camino por recorrer.

Mientras, se han instalado en ciertos ámbitos educativos (me atrevería a decir que sobre todo a nivel de gestión empresarial) una serie de neuromitos que hacen flaco favor a este objetivo a largo plazo que es la neuroeducación. Estos mitos han surgido por varios motivos. Una teoría científica ya superada, una interpretación incorrecta de ciertos trabajos científicos o el etiquetado fraudulento de "científicamente probado". ¿Quién no ha oído afirmaciones como que sólo utilizamos el 10% de nuestro cerebro, o que aprendemos mejor la información que nos llega por nuestro canal preferido (auditivo, visual o cinestésico)? Puedes encontrar más neuromitos en este estudio sobre la prevalencia de los mismos entre los profesores de primaria y secundaria de Holanda y Gran Bretaña.

Gracias a los organizadores (el Parque de las Ciencias) he podido seguir la charla de Francisco Mora a través de Internet y quería compartirla con vosotros. Si queréis escuchar directamente a Francisco id al minuto 16 aproximadamente.



Si te interesa conocer este tema más a fondo, además del libro de Francisco Mora publicado por Alianza Editorial, te recomiendo leer la guía editada por la OCDE La comprensión del cerebro: El nacimiento de una ciencia del aprendizaje que está disponible gratuitamente a texto completo. De esta guía he extraído el siguiente párrafo:
"Muchas veces la naturaleza humana se conforma con -en incluso se deleita en- explicaciones rápidas, simples e inequívocas. Inevitablemente esto lleva a interpretaciones incorrectas, extrapolaciones cuestionables y, en términos generales, la génesis de ideas falsas".
Todos conocemos el cuento del pastor que gritaba continuamente ¡que viene el lobo! Sería una lástima que cuando llegue la verdadera neuroeducación nos encontrásemos una sociedad descreída y agotada por los neuromitos.

jueves, 10 de octubre de 2013

Las proteínas, los Umpa Lumpa de los seres vivos

Si hay una molécula protagonista en la biología del siglo XX esta es sin duda el ADN. Sin embargo yo les tengo más cariño a las proteínas, más numerosas y variadas (no en vano me paso todo el día trabajando con ellas). Para mi son como los Umpa Lumpa (o Oompa Loompa), los pequeños duendes que hacen funcionar la fábrica de chocolate de Willy Wonka. 

A pesar del cariño que las tengo no son muy conocidas entre los niños, ya que no las estudian hasta que llegan a bachillerato y sólo si eligen la modalidad de ciencias. Pues sinceramente, esto me entristece un poco. Así que me he decidido a remediarlo y voy a contaros hoy algo sobre ellas. Los Umpa Lumpa son todos muy parecidos pero en realidad son diferentes ¿verdad?. Pues las proteínas son justo al revés: parecen muy diferentes pero en realidad son similares

Las proteínas se parecen porque son todas como cadenas construidas con eslabones de 20 tipos. El número total de eslabones que componen una proteína es muy variable: desde unos pocos hasta miles de ellos, pero únicamente de 20 tipos distintos. A estas cadenas las llamamos secuencias, y cuando trabajamos con ellas en el ordenador las escribimos como si fueran una palabra, utilizando 20 letras mayúsculas distintas (una por cada tipo de eslabón o aminoácido). 

Por ejemplo, la haditoxina es una proteína con 65 eslabones. Se trata de una toxina de la cobra real (Ophiophagus hannah). Esta proteína es responsable, junto con otras sustancias del veneno de la cobra, del bloqueo muscular que experimentan sus presas al ser mordidas por esta. Su secuencia es como sigue:

TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ

Sencillo ¿verdad? Un eslabón (o aminoácido) detrás de otro.

A su vez las proteínas son diferentes porque, aunque podamos pensar en ellas como cadenas de aminoácidos, en realidad estos se organizan en el espacio. ¡Las proteínas son siempre 3D!. Por eso la mayor parte de ellas tiene una forma característica. En la jerga científica decimos que las proteínas se pliegan. Retomando el ejemplo, conocemos la estructura 3D de la haditoxina de la cobra real y podemos representarla en el ordenador que nos la muestra así.
Estructura 3D de la haditoxina, una de las proteínas
que forma parte del veneno de la cobra real.
Más información en Protein Data Bank

Bonita y compleja a la vez ¿no crees? Puedes seguir el trazado de la cadena principal recorriendo la cinta coloreada (desde el extremo izquierdo al derecho siguiendo el rojo, pasando por el naranja, amarillo, verde, azul celeste y finalizando en la flecha añil).

¿Quieres ver qué formas tan distintas pueden llegar a tener las proteínas? En esta última imagen aparecen sólo algunas de las que conocemos su estructura 3D. Como hay proteínas con estructuras muy diferentes pueden hacer todo tipo de funciones en los seres vivos (igual que los Umpa Lumpa en la fábrica de chocolate). ¡No vayas a creer que todas las proteínas son veneno! Pero ésta es otra historia y te la contaré en otro momento.
Estructuras 3D de algunas proteínas.
Imagen de: Protein Data Bank.
Puedes descargar este poster en PDF
Esta entrada participa en el XXVIII Carnaval de Química organizado por Flagellum (@3DCiencia)
Esta entrada participa en el XXVI Carnaval de Biología (edición especial junior), organizado por La Rueda de los Inventos

jueves, 3 de octubre de 2013

El verdadero "campo de medusas"

De todos los niños es conocida la afición de Bob Esponja y su amigo Patricio por entretenerse jugando en el campo de medusas con sus atrapa-mariposas.

Bob Esponja en el campo de medusas
Bob Esponja en el campo de medusas
Imagen: www.iwallscreen.com
Viendo el primer capítulo de la serie de divulgación científica de la BBC "Wonders of life" (Maravillas de la vida) he llegado a conocer que, aunque increíble que parezca, el campo de medusas existe realmente (o al menos es lo más parecido en lo que yo pueda pensar). Se trata del conocido como "lago de las medusas", situado en Palau, un archipiélago del Océano Pacífico.

Este lago de agua salada está ecológicamente aislado del resto del océano y se encuentra plagado de unas medusas únicas (sólo se han encontrado aquí): las medusas doradas.

Estas medusas con especiales porque no pican tanto como las medusas a las que estamos acostumbrados a encontrar en la playa y porque viven en constate migración huyendo de sus depredadores (las anémonas) y buscando la luz del sol (sí, como las plantas).

Submarinista rodeado por medusas doradas.
Imagen: www.divetime.com
¿Por qué buscan el sol? Pues porque viven en estrecha convivencia con unas algas unicelulares, las zooxantelas. Este tipo de relación, que se llama simbiosis, permite a la medusa obtener la mayor parte de la energía que necesita para vivir a través de la fotosíntesis (indirectamente claro está). Las algas embebidas en las células de las medusas doradas sí son capaces de convertir la energía del sol en energía química, sintetizando moléculas complejas como la glucosa que servirá de alimento para las células de las medusas.

Ésta relación simbiótica con las algas explica en parte por qué las medusas doradas no tienen prácticamente tentáculos, ya que no necesitan buscar el alimento de la misma manera que si vivieran en el océano abierto.

En 2012 las Islas Rocosas donde se encuentra el lago de las medusas fue declarado Patrimonio de la Humanidad por la UNESCO. Si te animas a ir a verlo, pueden realizarse visitas turísticas.

Esta entrada participa en el XXVI Carnaval de Biología (edición especial junior), organizado por La Rueda de los Inventos.

martes, 1 de octubre de 2013

Anuncio del XXVI Carnaval de Biología

Tengo el honor de anunciar que a partir de hoy mismo,  y hasta el próximo día 31 de octubre de 2013, La Rueda de los Inventos será el blog anfintrión del XXVI Carnaval de Biología, también conocido como biocarnaval.

El Carnaval de Biología es, al igual que otros Carnavales (Física, Química, Geología...), un encuentro virtual en la red, que se organiza mensualmente y de manera itinerante. Cada edición está coordinada y acogida por un blog y cuenta con la participación voluntaria de otros muchos.

Como sabéis La Rueda de los Inventos está dedicada a la ciencia y la tecnología para niños (y niñas claro está). Así que no voy a proponer un tema concreto para las entradas que participen, pero sí un tono, el de la biología para todos los públicos. Así que esta vigésimo sexta edición será una edición especial, el Carnaval de Biología Júnior.

Biocarnaval Junior

Os invito a participar con vuestras entradas en forma de cuentos, historias, experimentos, vídeos, reflexiones o cualquier otro formato que se os ocurra que traten un aspecto de la Biología que pueda ser interesante para los niños. Las temáticas menos tratadas en los colegios son especialmente bienvenidas (en este sentido os animo a leer mi entrada sobre Niños, ciencia y aprendizaje informal).

Como en ediciones anteriores, se admitirán todo tipo de participaciones. Si la tuya encaja en la sección Júnior, por favor indícanoslo para marcarla como tal. También puedes colaborar leyendo y comentando las entradas participantes, así como difundiendo esta XXVI edición del carnaval.

Por lo demás, las normas de participación para esta edición serán las de siempre:
  • Participación libre, desde el propio blog o como autor invitado en el blog de un amigo, familiar, etc., también solicitándolo al anfitrión de turno del biocarnaval.
  • Cada mes el blog anfitrión anunciará el inicio del carnaval indicando la fecha de comienzo (se recomienda que sea la misma que la del anuncio y la fecha de fin del mismo, preferiblemente a finales de cada mes).
  • La temática será libre pudiendo ser de cualquiera de los muchos campos dentro de la biología: evolución, botánica, zoología, microbiología, bioquímica, genética, etc. Sin embargo, el anfitrión puede proponer un tema concreto sobre el que los participantes pueden escribir, dibujar, cantar, o lo que tengan pensado.
  • Cada entrada (post) publicada deberá indicar que participa en la n-Edición del Carnaval de Biología citando y enlazando al blog organizador. Tenéis dos posibles formas de avisar, directamente al blog anfitrión dejando un comentario en esta entrada o al twitter del carnaval @biocarnaval.
  • Cada organizador puede proponer mejoras y cambios para el biocarnaval.

Aquí puedes encontrar una lista de las anteriores ediciones:
Parece que la edición especial júnior del biocarnaval era casi inevitable después del tema propuesto en la última edición...
XXVI Carnaval de Biología. Especial Júnior. Varios autores. Organizado, en esta edición por La Rueda de los Inventos
¡Os animo a participar, leer, comentar y difundir desde ahora mismo!


Aquí aparecerán las contribuciones de esta edición según vayan llegando:

Esta XXVI edición del Carnaval de Biología ya ha terminado. Puedes encontrar un resumen de la edición aquí. ¡Hasta pronto!

jueves, 26 de septiembre de 2013

Tesla, el genio de la tecnología

Pocos inventores pueden reunir en su vida tantos ingredientes atractivos para leer su biografía. Y es que la historia de Nikola Tesla no fue precisamente un camino de rosas. Una infancia un tanto enfermiza, una etapa de adicción al juego, estancias en varios países y multitud de contribuciones científicas y tecnológicas.

Además fue un genio que no logró el reconocimiento merecido en su época, y que tuvo sus más y sus menos con otros dos científicos coetáneos: Thomas Edison y Guillermo Marconi. Para muestra un botón. Estoy segura que sabes contestar si te pregunto ¿qué inventó Edison? y ¿qué inventó Marconi?. Ahora bien, ¿qué inventó Tesla?
Tesla el genio de la tecnología
Tesla el genio de la tecnología
Imagen: El Rompecabezas

Pues Tesla no es ni más ni menos que el padre del moderno sistema de distribución de la electricidad basado en la corriente alterna. Además desarrolló el primer sistema de radio control (el precursor del actual mando a distancia), la lámpara fluorescente inalámbrica, y la bobina Tesla.

En "Tesla el genio de la tecnología", Sergi Aguilar narra su vida de una manera entretenida, rigurosa y pedagógica.

Al igual que los otros títulos de la colección sabelotod@s, este libro incluye un glosario explicando algunos conceptos relevantes y cuatro curiosos experimentos muy apropiados para entender y aprender más sobre los inventos de Tesla.

Mi sugerencia... léelo tú también. Se te abrirá el apetito de saber más sobre Nikola Tesla.

Tesla el genio de la tecnología de Sergi Aguilar, Ediciones El Rompecabezas. A partir de 9 años.
Lo peor: Algún capítulo puede resultar difícil de seguir a los niños, dada la multitud de contribuciones e inventos de Tesla.

Lo mejor: Las reflexiones sobre el proceso científico y tecnológico como una actividad humana, con sus virtudes y sus defectos. Todo ello, además de presentarnos la vida de Tesla.

jueves, 19 de septiembre de 2013

La noche de los investigadores

Apunta una fecha en tu calendiario: viernes 27 de Septiembre, y resérvala para dedicarla a la ciencia. Será una noche muy especial: la noche de los investigadores.

La Noche de los Investigadores
La Noche de los Investigadores se celebra anualmente, el cuarto viernes de septiembre. Podríamos decir que es el Halloween de los científicos, o si lo prefieres la fiesta del verano en otoño dedicada a la investigación. En definitiva, la celebración de la ciencia para todas las edades (desde niños a adultos).

¿Quieres descubrir qué hacen los científicos? ¿Quieres que te lo cuenten ellos mismos?

No te la pierdas. Las actividades suelen tener un aforo limitado. Consulta cómo se va a celebrar en tu localidad.

Más información en:

La Noche de los Investigadores. Una iniciativa de la Comisión Europea que se celebra anualmente en multitud de ciudades europeas. Todos los años, el cuarto viernes de septiembre.

domingo, 15 de septiembre de 2013

La Rueda de los Inventos cumple 6 meses

Efectivamente, hoy se cumplen 6 meses desde que escribí mi primera entrada en este blog. Y creo que va siendo hora de actualizar la respuesta a la pregunta ¿qué es la Rueda de los Inventos? 

Mi deseo de acercar la ciencia y la tecnología a los niños y más jóvenes sigue vivo, y es más intenso si cabe. Comentaba en "El Comienzo" que eran muchos los esfuerzos dedicados a la divulgación científica en España, y que la mayor parte estaban pensados para los adultos. Esto lo he constatado. 

Sin embargo, lo que me ha sorprendido ha sido encontrar un notable número de personas involucradas en el acercamiento de la ciencia y la tecnología a los niños, ya sea desde la perspectiva de la educación formal como desde la divulgación más informal. Gracias a este blog he conocido y charlado con algunos de ellos. Por eso, muchos de mis comentarios en la Rueda de los Inventos son reseñas sobre recursos y actividades realizadas tanto en el mundo real como el mundo virtual creadas por otras personas a nivel personal o en distintas organizaciones o empresas. 

También es cierto que hay todavía mucho por hacer y por aprender. Por eso mi mirada se posa de vez en cuando en la labor que se realiza en esta línea fuera de nuestras fronteras. 

Finalmente destaco las visitas recibidas desde muchos puntos del planeta, especialmente desde Hispanoamérica. Y es que la ciencia y el deseo de conocerla y difundirla es internacional. 

Mi agradecimiento a todos los que habéis leido y comentado las entradas, a los que me habéis hecho llegar vuestro apoyo, sugerencias y material vía correo electrónico o personalmente. Gracias a los que habéis publicitado el blog y los que seguís a @RuedaInventos a través de Twitter. ¡Sin vosotros este pequeño proyecto no sería posible! 

Las cifras solas no dicen nada. No sé si es mucho o poco, para mí en estos momentos es una barbaridad. Os aseguro que las cerca de 8.000 páginas vistas y un centenar de seguidores en Twitter en sólo 6 meses son para mí una constatación de que queremos y podemos mejorar el futuro de la ciencia en España. 

Por eso dejadme soñar y ser optimista (es el tono que no quiero abandonar en este blog) y darle la vuelta al lema "sin ciencia no hay futuro". Hoy, como siempre, "Con ciencia hay futuro".

Con ciencia hay futuro
Con ciencia hay futuro




jueves, 12 de septiembre de 2013

Niños, ciencia y aprendizaje informal

En estas semanas estamos inmersos en la operación "vuelta al cole". Unos antes, otros después, poco a poco las aguas bravas vuelven a su cauce habitual. El calendario escolar parece que sigue marcando nuestras vidas, incluso cuando hace tiempo que dejamos de ser estudiantes.

¿Pero sabes cuánto tiempo dedicamos en nuestra vida a actividades de educación formal? Sólo un 9% de las horas que permanecemos despiertos*. Incluso durante la etapa escolar los niños dedican más horas al aprendizaje informal que al formal.
LIFE Center: Stevens, R. Bransford, J. & Stevens, A., 2005

Tiempo dedicado al aprendizaje en entornos formales (naranja) e informales (azul)
a lo largo de nuestra vida
Fuente: LIFE Center: Stevens, R. Bransford, J. & Stevens, A., 2005

Si queremos mejorar la educación científica de la sociedad, tendremos que facilitar tanto entornos de aprendizaje formales e informales. Especialmente en el caso de los adultos, pero también en el caso de los niños. No podemos ni debemos descargar toda la responsabilidad de enseñar ciencia a los colegios o centros de enseñanza superiores.

Ésta es una de las principales conclusiones del informe Learning Science in Informal Environments (El aprendizaje de la ciencia en entornos informales) - elaborado en 2009 por un comité de catorce expertos del National Research Council (NRC) estadounidense.

Cuando se trata de la ciencia, muchas veces pasamos por alto las oportunidades de aprendizaje de los niños en el entorno extra-escolar. Pero ¿dónde se puede aprender ciencia fuera del cole? El informe del NRC señala tres entornos:
  • Aprendizaje en el día a día y el entorno familiar
  • Entornos diseñados a tal fin (como museos, centros de ciencia, zoos, jardines botánicos, aquariums, etc.)
  • Programas extraexcolares (campamentos, clubes, charlas, etc.)
El conocimiento previo, la motivación y los intereses personales son cruciales en el aprendizaje informal. Los niños no tienen acceso a los medios educativos si no es a través de los adultos. Por lo tanto todos nosotros como padres, familiares, educadores o divulgadores jugamos un papel fundamental en el aprendizaje informal de la ciencia. En algunos casos nuestras propias preferencias pueden actuar como filtros que impidan a los niños descubrir aquello que más les llama la atención. Por eso es importante que ofrezcas un abanico amplio de temáticas y actividades distintas a los niños.

Las primeras y más profundas experiencias de aprendizaje de las ciencias en los niños serán probablemente en el entorno extra-escolar. Éstas experiencias podrán influir positivamente en el aprendizaje académico de la ciencia, así como la elección de estudios posteriores o la disposición futura e interés hacia temas científicos.

En próximas entradas desarrollaré más en profundidad algunas ideas del informe NRC. Mientras, espero que en este blog encuentres alguna experiencia de aprendizaje informal para tus hijos (sobrinos, nietos) y/o alumnos:
Si la experiencia es positiva, te invito a que nos la comentes...


jueves, 5 de septiembre de 2013

Un paseo por el genoma humano

Si hace unas semanas os invitaba a dar un paseo por el espacio de la mano de la industria aeroespacial española, hoy os animo a dar un paseo por el genoma humano guiados por el Instituto Suizo de Bioinformática (Swiss Institut of Bioinformatics). Eso sí, en este caso nuestros guías nos "hablarán" en inglés, francés o alemán. A pesar del esfuerzo creo que vale la pena. 

El paseo del cromosoma
El paseo del cromosoma
(Chromosome Walk)
Imagen: chromosomewalk.ch
El recorrido que nos presenta Chromosome Walk discurre por los 23 pares de cromosomas, los componentes en que se organiza nuestro genoma durante la división celular. Te recomiendo que empieces por la sección ¿De qué estamos hechos? (What are we made out of?). Aquí encontrarás una explicación gráfica y textual muy sencilla y aclaratoria de las relaciones entre la célula, su núcleo, el genoma humano (organizado en 23 pares de cromosomas y codificado en forma de secuencia en la molécula del ADN), los genes que contiene y cómo éstos codifican el ARN mensajero (otro tipo de molécula) que serán finalmente interpretados por el ribosoma para "fabricar" las proteínas (un tercer tipo de molécula esencial para la vida).

En este paseo nos toparemos con muchos genes y proteínas, y también podemos entender un poquito de qué va eso de la bioinformática (¿bio qué? - bioinformática, eso a lo que me dedico). Te recomiendo que leas también Para qué necesitamos la bioinformática.

Una vez que hemos entendido estos conceptos ¡estamos listos para empezar el paseo!. Sólo hay que seleccionar uno de los 24 cromosomas que nos proponen. Espera Mónica, ¿pero no eran 23 pares?. Sí 22 son pares idénticos, y el par 23 está constituido por dos cromosomas iguales (XX) en el caso de las "niñas" o dos cromosomas distintos (XY) en el caso de los "niños". Así que en total podemos hablar de 24 cromosomas humanos diferentes.

En cada cromosoma encontramos datos del mismo (su longitud, cuántos genes contiene...) y curiosidades (por ejemplo, que el cromosoma 1 fue precisamente el último que se secuenció). Además podremos aprender algo más de algunos de los genes que contiene, y de las proteínas que éstos codifican. Por último, cada cromosoma nos desarrolla más en profundidad un tema diferente (como la historia del proyecto genoma humano, por qué necesitamos ingerir vitamina C en nuestra dieta mientras que otros mamíferos no, etc.).

El portal incluye un glosario (al que puedes acceder de forma global, o ver en contexto al pasar con el ratón por encima de algunos términos), un par de pruebas para evaluar lo que has aprendido (con dos niveles: sencillo o experto), y numerosos enlaces para indagar más a fondo sobre los temas comentados.

www.chromosomewalk.ch - A saunter along the human genome (Un paseo por el genoma humano), desarrollado por el Instituto Suizo de Bioinformática (Swiss Insitute of Bioinformatics). 

Aunque ellos mismos dicen que el portal es para todos (de 9 a 99 años), los niños más pequeños necesitarán que les acompañes en el paseo. Yo lo recomiendo especialmente para estudiantes de los últimos cursos de secundaria y de bachiller (elijan o no la especialidad de ciencias). Y por supuesto para todos los adultos interesados en aprender de forma entretenida y sencilla qué es el genoma humano y por qué es importante.

Nota: Si no entiendes nada de francés, alemán o inglés, mi primera recomendación es que te pongas las pilas con el inglés... Mientras tanto puedes navegar con Google Chrome y habilitar la traducción de la página. La sintaxis no es siempre perfecta, pero se hace entender.

Esta entrada participa en la XXV Edición del Carnaval de Biología (Biocarnaval), organizada por Ser vivo.

jueves, 22 de agosto de 2013

Descubre con Tadeo y ¡alimenta tu cerebro!

Este verano el intrépido y torpe Tadeo Jones nos está presentando, entre anuncio y anuncio de los distintos canales de televisión del grupo Mediaset, algunos de los proyectos científicos y de divulgación que se están realizando en España. Se trata de unos vídeos muy breves (sólo 2 minutos de duración) que seguro captan la atención de los niños. 

Descubre con Tadeo.
Imagen: www.telecinco.es
De momento hemos podido ver, si es que los hemos pillado, cuatro capítulos. A pesar de tener que "tragarse" el o los anuncios correspondientes (a veces poco pensados para los niños precisamente), puedes verlos tranquilamente en la página web de Telecinco

En la sierra de Atapuerca, en Burgos, se encuentra uno de los conjuntos de yacimientos fósiles y arqueológicos más importantes de la Península Ibérica. Para más información sobre la evolución humana y los yacimientos visita el Espacio Didáctico en la página web de la Fundación Atapuerca. Tadeo también nos anima a visitar el Museo de la Evolución Humana, en Burgos.

El gran telescopio de Canarias está en el Observatorio del Roque de los Muchachos, un maravilloso enclave en la isla de La Palma. Pertenece al Instituto de Astrofísica de Canarias, y cuenta con participación de Méjico y Estados Unidos. Te recomiendo que visites su galería de imágenes, la visita panorámica de su exterior y que leas un breve documento de prensa que prepararon para su inauguración en el año 2009.

La Plataforma solar de Almería (PSA) es un centro de investigación que depende del Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (conocido por sus siglas, mucho más sencillas de recordar; CIEMAT). Se considera el mayor centro de investigación sobre energía solar en Europa. Actualmente puede visitarse, previa reserva. Como nos cuenta Tadeo, en el PSA se averigua cómo podemos aprovechar la energía del sol. Y es que de momento el sol no nos falta...

Capítulo 4: Dinópolis
El parque temático sobre la paleontología en Teruel se llama Dinópolis. Los fósiles y reproducciones de dinosaurios harán seguro las delicias de los niños.

Últimos capítulos que se han ido emitiendo:

Capítulo 5: Altamira
Capítulo 6: Marenostrum
Capítulo 7: Museo Geominero
Capítulo 8: Laboratorio subterráneo de Canfrac
Capítulo 9: Sincrotrón Alba

Descubre con Tadeo. Serie de cortos sobre distintos proyectos científicos españoles. Para todas las edades. Puedes ver todos los capítulos en HD en el canal oficial de Tadeo Jones.

Lo peor: El formato, de sólo 2 minutos, no da para casi nada.

Lo mejor: La labor divulgativa sobre la ciencia en España.

Licencia CC

Licencia Creative Commons
La Rueda de los Inventos por Monica Chagoyen se encuentra bajo una Licencia Creative Commons Atribución 3.0 Unported. Citar: www.laruedadelosinventos.org.
Related Posts Plugin for WordPress, Blogger...